Change theme to redChange theme to blueChange theme to greenChoose your color

Technologies Available for Licensing

For Licensing Opportunities, please contact the ORTA at


This invention relates to amino acid sequences from within a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

Docket:WRAIR 95-10D

Publication/Issued No.:7,404,961

Publication/Issue Date:2008-07-29

Categories: Method

More Detail:Visit USPTO.GOVExternal link


Inventor(s):CASSELS, ET AL

For Licensing Opportunities, please contact the ORTA at

Last Modified Date: 28 Aug 2019

This Web site provides an introduction to the Office of Research and Technology Applications (ORTA) and contains official Government information.

Its use is intended for members of the general public, news media and Military Health System beneficiaries.

Please address questions or concerns about this Web site to the USAMRDC Public Affairs Office at: or by telephone at (301)619-2736