Change theme to redChange theme to blueChange theme to greenChoose your color

Technologies Available for Licensing

For Licensing Opportunities, please contact the ORTA at


A monoclonal antibody to a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. (SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Docket:WRAIR 95-10B

Publication/Issued No.:7,566,540

Publication/Issue Date:2009-07-28

Categories: Method

More Detail:Visit USPTO.GOVExternal link


Inventor(s):CASSELS; F.; LEES; A.; SCHUMAN, R.

For Licensing Opportunities, please contact the ORTA at

Last Modified Date: 28 Aug 2019

This Web site provides an introduction to the Office of Research and Technology Applications (ORTA) and contains official Government information.

Its use is intended for members of the general public, news media and Military Health System beneficiaries.

Please address questions or concerns about this Web site to the USAMRDC Public Affairs Office at: or by telephone at (301)619-2736